Dataset for protein Bmf of organism Myotis lucifugus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1PAU1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Myotis lucifugus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDELGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQWQHHRAEIQIARKLQSIADQFHRLQMQQHQQNRNRMW
WQFLLFLHNLALNGDENRNGAGPR
© 1998-2018