Dataset for protein Bad of organism Myotis lucifugus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1P8C5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Myotis lucifugus GN=BAD (length=174 residues).
PTAQSMFQIPEFEHSEQEDSSPADRGLGPCPTGDQPPGLNKHWSTVPGLLGEAGHQQGQPASSSHHDGAGSVEPRSRHSS
YPTGTEEDDDTEEGEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGSFKKGLPRPKSAGTATQMWQKSSWTRFFQSW
WDRNSGRGGSAPSQ
© 1998-2018