Dataset for protein classical BH3-containing proteins of organism Mustela putorius furo

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|M3Y0R3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mustela putorius furo GN=BBC3 (length=201 residues).
QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLWESDCSPRVAAHGLFRAGAAAVSQPPPPPVWVSLT
SQRTIVGGSVGRARGLLFPGPQPSLSPAEPHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY
ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|M3YAD5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mustela putorius furo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|M3YDI3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L11 (length=232 residues).
MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLCLPRFFRAEGQGAPGRRRTRAGRRGARARTR
RSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYL
SAMASRRQSQAVPADMRPEMWIAQELRRIGDEFNAYYPRRVFLNNYPAAEAHPQMIILRLLRYIIRLVWRLQ
>gnl|bcl2dbpro|M3YNE7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mustela putorius furo GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGLGKHLQTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEELSPFRGRSRSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLG
RGGSAPSQ
© 1998-2018