Dataset for protein Bmf of organism Mustela putorius furo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3YAD5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mustela putorius furo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
© 1998-2018