Dataset for protein Puma of organism Mustela putorius furo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3Y0R3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mustela putorius furo GN=BBC3 (length=201 residues).
QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLWESDCSPRVAAHGLFRAGAAAVSQPPPPPVWVSLT
SQRTIVGGSVGRARGLLFPGPQPSLSPAEPHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY
ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2018