Dataset for protein Bad of organism Mustela putorius furo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3YNE7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mustela putorius furo GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGLGKHLQTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEELSPFRGRSRSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLG
RGGSAPSQ
© 1998-2018