Dataset for protein Hrk of organism Mus musculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P62816_HRK-03 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Mus musculus GN=HRK (length=92 residues).
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
© 1998-2018