Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

17 sequence(s)

>gnl|bcl2dbpro|A2AV74_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=271 residues).
MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLS
WSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A2AV74_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=190 residues).
MSPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQ
NRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|O54918_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=91 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQV
AQNIHGDAWYN
>gnl|bcl2dbpro|O54918_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNET
YTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVF
ANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVF
ANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O70337_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=143 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGG
>gnl|bcl2dbpro|O70337_BIK-04 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=106 residues).
MFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPD
QDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|P62816_HRK-03 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Mus musculus GN=HRK (length=92 residues).
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|Q61337_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mus musculus GN=BAD (length=162 residues).
MFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEG
MEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTP
SQ
>gnl|bcl2dbpro|Q61337_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mus musculus GN=BAD (length=204 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPG
LLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ
>gnl|bcl2dbpro|Q61337_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mus musculus GN=BAD (length=178 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPG
LLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGEELTYSLSPFRCVQ
>gnl|bcl2dbpro|Q99ML1_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|Q9JM54_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=103 residues).
MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRR
IGDKVNLRQKLLNLISKLFNLVT
© 1998-2018