Dataset for protein Bik of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|O70337_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-04 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=106 residues).
MFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPD
QDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
© 1998-2018