Dataset for protein Bim of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|O54918_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=91 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQV
AQNIHGDAWYN
>gnl|bcl2dbpro|O54918_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNET
YTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVF
ANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVF
ANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
© 1998-2018