Dataset for protein classical BH3-containing proteins of organism Monopterus albus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q3K6I5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Monopterus albus GN=BCL2L11 (length=236 residues).
MHLSRPPNRSDGSTAVTATEESGDPPSVGAAGTSAQSSRSNGGSERSFGHPGSAGGGEPVSPSRCRTKAIAPLDSLSVFH
TRSIFHLPRRSSSGYFSNDSDSVPSSPLSPRPVTADKVTQTPSPSSQVMNHALQCMAEAHGGRPGTHRQDASSPSPSSAR
QQNAIRDMQAEAVGRELRRIGDDYNNHLLELADRRRRVVPRIHQELTIVLCVGILVLVIGQIILQGSINSQDNSQV
>gnl|bcl2dbpro|A0A3Q3QZ16_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monopterus albus GN=BMF (length=160 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYGNAGFRLHFPAHFELVGDQEARR
QEDQNGMEHLPRQQRVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q3QZ16_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Monopterus albus GN=BMF (length=160 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYGNAGFRLHFPAHFELVGDQEARR
QEDQNGMEHLPRQQRVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q3R5S3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Monopterus albus GN=BAD (length=168 residues).
MAANFTISDSESESSEEVEEGKHSQSSTSQEQQVPPCHSLTLPELRMAATSRNRVSSESNASTVQDAKSDEEAGTPTDGA
PFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKRVRSAGAASQMHHSKSWWSYLFSHQETEGENTHHENAALA
QEVERVVS
© 1998-2019