Dataset for protein Bim of organism Monopterus albus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3K6I5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Monopterus albus GN=BCL2L11 (length=236 residues).
MHLSRPPNRSDGSTAVTATEESGDPPSVGAAGTSAQSSRSNGGSERSFGHPGSAGGGEPVSPSRCRTKAIAPLDSLSVFH
TRSIFHLPRRSSSGYFSNDSDSVPSSPLSPRPVTADKVTQTPSPSSQVMNHALQCMAEAHGGRPGTHRQDASSPSPSSAR
QQNAIRDMQAEAVGRELRRIGDDYNNHLLELADRRRRVVPRIHQELTIVLCVGILVLVIGQIILQGSINSQDNSQV
© 1998-2019