Dataset for protein Bad of organism Monopterus albus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3R5S3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Monopterus albus GN=BAD (length=168 residues).
MAANFTISDSESESSEEVEEGKHSQSSTSQEQQVPPCHSLTLPELRMAATSRNRVSSESNASTVQDAKSDEEAGTPTDGA
PFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKRVRSAGAASQMHHSKSWWSYLFSHQETEGENTHHENAALA
QEVERVVS
© 1998-2019