Dataset for protein Bmf of organism Monodelphis domestica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6X3N6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monodelphis domestica GN=BMF (length=184 residues).
MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPASFPASLRLGEEPPEEQWEHRAEVQIAQKLQCIADQFHRLHMQRHQQNRNHVW
WQILLFLHNLALNREENRNGAGPR
© 1998-2018