Dataset for protein classical BH3-containing proteins of organism Mola mola

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q3VLX6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mola mola GN=BMF (length=149 residues).
MDDDEDDVFEPEAHCWRTTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFYVTSSLAPDSRDNCRERNGMERLP
RQQPVAHSVEACIGQKLQLIGDQFHREHMQLYHRNQRNQGPLWWRLGSALLSLLFDRGFFAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q3WTY4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mola mola GN=BAD (length=145 residues).
MATNFTISSDSESELSEEIEEGENSQLQTEQEQQVFQRHTLTLPELRMAGRTLQVKGEDEAGTPTDGAPFRGRSKSAPPS
LWAAKKYGQRLRRMSDEFDRQEWKTRSAGTATQMHQSRSWWSYLFSHQETDGENNHHDSHTHRNE
© 1998-2019