Dataset for protein Bmf of organism Mola mola

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3VLX6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mola mola GN=BMF (length=149 residues).
MDDDEDDVFEPEAHCWRTTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFYVTSSLAPDSRDNCRERNGMERLP
RQQPVAHSVEACIGQKLQLIGDQFHREHMQLYHRNQRNQGPLWWRLGSALLSLLFDRGFFAGGGGAGRR
© 1998-2019