Dataset for protein Noxa of organism Mesocricetus auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1U7QLK6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mesocricetus auratus GN=PMAIP1 (length=105 residues).
MLQSVARQNAPSNPARAELAPEFIAQLRRIGDKLSSEWCEPDIIAVLAEMPGKKARKSVTRIPSPTRVPTDVEDECVHQL
RRIGDKQNLRQKLLNFISKLFSLVT
© 1998-2018