Dataset for protein Hrk of organism Mesocricetus auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1U7R468_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Mesocricetus auratus GN=HRK (length=92 residues).
MCPCPRHRGHGPPAVCGCGDTRPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
© 1998-2018