Dataset for protein classical BH3-containing proteins of organism Mesocricetus auratus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A1U7Q4V0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mesocricetus auratus GN=BAD (length=204 residues).
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAAQSMFQIPEFEPSEQEDSNTADRGLGPSLTGDPPGPCLAPG
LLGNIRHQQEQAANSSHHGGTGAMETRSRHSSYTAGNEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
>gnl|bcl2dbpro|A0A1U7QLK6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mesocricetus auratus GN=PMAIP1 (length=105 residues).
MLQSVARQNAPSNPARAELAPEFIAQLRRIGDKLSSEWCEPDIIAVLAEMPGKKARKSVTRIPSPTRVPTDVEDECVHQL
RRIGDKQNLRQKLLNFISKLFSLVT
>gnl|bcl2dbpro|A0A1U7R468_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Mesocricetus auratus GN=HRK (length=92 residues).
MCPCPRHRGHGPPAVCGCGDTRPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|A0A1U7R5N5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mesocricetus auratus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRGEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|A0A1U8BW10_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADIRPEIWIAQELRRIGDEFNESYRRRVNNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A1U8BW10_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L11 (length=90 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDLCENLKHE
WQIHGDQSKS
>gnl|bcl2dbpro|A0A1U8BW10_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPDGEGDRCPHGSPQGPLAPPASPGPSATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQELRRIGDEFNES
YRRRVNNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A1U8CPE0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mesocricetus auratus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRDRAW
WQVFLFLQNLALNREENREGVGPW
>gnl|bcl2dbpro|A0A1U8CPE0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mesocricetus auratus GN=BMF (length=189 residues).
IFPGEMEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RDRAWWQVFLFLQNLALNREENREGVGPW
© 1998-2018