Dataset for protein Bmf of organism Mesocricetus auratus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A1U8CPE0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mesocricetus auratus GN=BMF (length=189 residues).
IFPGEMEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RDRAWWQVFLFLQNLALNREENREGVGPW
>gnl|bcl2dbpro|A0A1U8CPE0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mesocricetus auratus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRDRAW
WQVFLFLQNLALNREENREGVGPW
© 1998-2018