Dataset for protein Bad of organism Mesocricetus auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1U7Q4V0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mesocricetus auratus GN=BAD (length=204 residues).
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAAQSMFQIPEFEPSEQEDSNTADRGLGPSLTGDPPGPCLAPG
LLGNIRHQQEQAANSSHHGGTGAMETRSRHSSYTAGNEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
© 1998-2018