Dataset for protein classical BH3-containing proteins of organism Meleagris gallopavo

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G1MV54_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L11 (length=72 residues).
FLLCAASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRGFLDNHAGNPQVVILRLLHYIIRLIWRMQ
>gnl|bcl2dbpro|G1NHG8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
© 1998-2018