Dataset for protein Bim of organism Meleagris gallopavo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1MV54_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L11 (length=72 residues).
FLLCAASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRGFLDNHAGNPQVVILRLLHYIIRLIWRMQ
© 1998-2018