Dataset for protein classical BH3-containing proteins of organism Maylandia zebra

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P9B2E4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Maylandia zebra GN=BAD (length=130 residues).
MAANFKISDSDSEASEEVGEGENQQSAGQAQESKPQTLSLPVTKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGVRMGVSQGLN
>gnl|bcl2dbpro|A0A3P9DPJ5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Maylandia zebra GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3P9DPJ5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Maylandia zebra GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
© 1998-2019