Dataset for protein classical BH3-containing proteins of organism Mastacembelus armatus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3Q3LME3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=163 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFDRGFIAGGGRA
GRR
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=154 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLQVGWAPETSGSLPVLLACLTLITGVWREG
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=167 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFDRGFIAGGGRA
GRRPPCP
>gnl|bcl2dbpro|A0A3Q3RXS8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mastacembelus armatus GN=BAD (length=155 residues).
MAAKFSISESESDSSEEVEGGKQKKSSARQEQQVSQRHALALPELRTTASNRIRLSSESQSRVDEEAGTPTDGAPFRGRS
KSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRVRNAGKAQKMHHSKTWWSYLFSYQETDGENNLHENHTPRTE
>gnl|bcl2dbpro|A0A3Q3RXS8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mastacembelus armatus GN=BAD (length=155 residues).
MAAKFSISESESDSSEEVEGGKQKKSSARQEQQVSQRHALALPELRTTASNRIRLSSESQSRVDEEAGTPTDGAPFRGRS
KSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRVRNAGKAQKMHHSKTWWSYLFSYQETDGENNLHENHTPRTE
>gnl|bcl2dbpro|A0A3Q3SYA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L11 (length=145 residues).
MATEESGDPPAGDPRVSAQTSRSNGGTDQSSVSPSRGRTRSIAHLDSLSVFHTRSIFQLPRRSSSGYFSSDGDSLPSSPL
SPRPVTADKATQTPSLTSQVMNHALQRLAEAHGGGAGAHRQHGEHKHLRSRLFTAHAEYTQVKQP
© 1998-2019