Dataset for protein Bmf of organism Mastacembelus armatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q3LME3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=163 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFDRGFIAGGGRA
GRR
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=154 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLQVGWAPETSGSLPVLLACLTLITGVWREG
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=167 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFDRGFIAGGGRA
GRRPPCP
© 1998-2019