Dataset for protein Bim of organism Mastacembelus armatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3SYA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L11 (length=145 residues).
MATEESGDPPAGDPRVSAQTSRSNGGTDQSSVSPSRGRTRSIAHLDSLSVFHTRSIFQLPRRSSSGYFSSDGDSLPSSPL
SPRPVTADKATQTPSLTSQVMNHALQRLAEAHGGGAGAHRQHGEHKHLRSRLFTAHAEYTQVKQP
© 1998-2019