Dataset for protein Bmf of organism Macaca nemestrina

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2K6B5G4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2018