Dataset for protein Noxa of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1D5QGJ8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca mulatta GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIW
RQTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCN
© 1998-2018