Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Alignment] [Repertoires]

17 sequence(s)

>gnl|bcl2dbpro|A0A1D5QGJ8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca mulatta GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIW
RQTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCN
>gnl|bcl2dbpro|A0A1D5R1E4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Macaca mulatta GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|F7CM09_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
>gnl|bcl2dbpro|F7FFP6_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Macaca mulatta GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|F7GVS7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|F7GVS7_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=82 residues).
MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKVSAGPPPRPPRAGLSLPCPKARPDLMSHDPSPTPSCPFL
AP
>gnl|bcl2dbpro|F7GVS7_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPS
ARMLAEASARMSAPATDSEAQHAENVKLKALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
>gnl|bcl2dbpro|F7GVS7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRCM
>gnl|bcl2dbpro|F7HHA9_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=75 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCCPSWSALVLSWLTATSNSQVQAVLLPQPPK
>gnl|bcl2dbpro|F7HHA9_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|F7HHA9_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|F7HHA9_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|F7HHA9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|F7HHA9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|F7HHA9_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=95 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLEWLA
>gnl|bcl2dbpro|F7HHA9_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|F7HHA9_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
© 1998-2018