Dataset for protein Bmf of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7CM09_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
© 1998-2018