Dataset for protein Bad of organism Macaca mulatta

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|F7GVS7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|F7GVS7_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=82 residues).
MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKVSAGPPPRPPRAGLSLPCPKARPDLMSHDPSPTPSCPFL
AP
>gnl|bcl2dbpro|F7GVS7_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPS
ARMLAEASARMSAPATDSEAQHAENVKLKALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
>gnl|bcl2dbpro|F7GVS7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRCM
© 1998-2018