Dataset for protein Noxa of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
© 1998-2018