Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

20 sequence(s)

>gnl|bcl2dbpro|A0A2K5V8J3_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Macaca fascicularis GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K5VCD8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca fascicularis GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A2K5VCD8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca fascicularis GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRCM
>gnl|bcl2dbpro|A0A2K5VCD8_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca fascicularis GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPS
ARMLAEASARMSAPATDSEAQHAENVKLKALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K5VW94_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca fascicularis GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLEWLASS
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|G7PAW6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|G7PAW6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|Q2PG01_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca fascicularis GN=BAD (length=82 residues).
MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
SQ
© 1998-2018