Dataset for protein Bmf of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G7PAW6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|G7PAW6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2018