Dataset for protein Bik of organism Macaca fascicularis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5VW94_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca fascicularis GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
© 1998-2018