Dataset for protein Puma of organism Macaca fascicularis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5V8J3_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Macaca fascicularis GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018