Dataset for protein Noxa of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3T0P7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Loxodonta africana GN=PMAIP1 (length=58 residues).
MPGKKARKSAQPGPAGTPAGTQQRDVVECAIQLRRIGDKINFRQKLLNVICKLFCSGT
© 1998-2018