Dataset for protein Hrk of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3UH24_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Loxodonta africana GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLRRRNL
© 1998-2018