Dataset for protein classical BH3-containing proteins of organism Loxodonta africana

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|G3SU55_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQPPQLRPGAPTSLLTEPQGNPDGEGDSCPQGSPQGPQAPPASPGPFATRSPLFI
FVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQALPADLRPEIWIARELRRIGDEF
NAYYPRRAFLNNYQAAEDHPQMVILRLLRYIVRLVWR
>gnl|bcl2dbpro|G3T0P7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Loxodonta africana GN=PMAIP1 (length=58 residues).
MPGKKARKSAQPGPAGTPAGTQQRDVVECAIQLRRIGDKINFRQKLLNVICKLFCSGT
>gnl|bcl2dbpro|G3T2N1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Loxodonta africana GN=BBC3 (length=186 residues).
MARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGLCEPGLPRVAGPRLLPGPRTQLFPSPSPVWVSDLSGLQLERG
GAEWEDRAPRPLSGPQPSLSPAEQHLESPVPTQAAPGVRGEDEQWAREIGAQFRRKADDLYALYERSVRQEEQHRHRPSP
WRVLYNLIMGLLPLPRDHGAPEMEPN
>gnl|bcl2dbpro|G3T7Z4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Loxodonta africana GN=BMF (length=268 residues).
MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWS
HPGEMEPSQCVEELEDDVFQPEEGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADHFHRLHMQRHQQNR
NPAWRQILQFLHHLAVNGEENRNGAGPR
>gnl|bcl2dbpro|G3TP47_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Loxodonta africana GN=BAD (length=206 residues).
GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSSGGLQSMFQIPEFEQSDREDSTPADRGLGPSPEGYWPSGPSDRHRVA
PGFLRDSSHQQGQPTSSGHHGGAAAVETRSRHSSYPAGSDEAEGLEEDPSPFRGRSLSAPPNLWAAQRYGRELRRMSDEF
QGYFKGLPRPKSAGTATQMRQSPSWTRIIQAWWDRNLGRGSSAPSQ
>gnl|bcl2dbpro|G3UH24_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Loxodonta africana GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLRRRNL
© 1998-2019