Dataset for protein Bmf of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3T7Z4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Loxodonta africana GN=BMF (length=268 residues).
MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWS
HPGEMEPSQCVEELEDDVFQPEEGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADHFHRLHMQRHQQNR
NPAWRQILQFLHHLAVNGEENRNGAGPR
© 1998-2018