Dataset for protein Bim of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3SU55_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQPPQLRPGAPTSLLTEPQGNPDGEGDSCPQGSPQGPQAPPASPGPFATRSPLFI
FVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQALPADLRPEIWIARELRRIGDEF
NAYYPRRAFLNNYQAAEDHPQMVILRLLRYIVRLVWR
© 1998-2018