Dataset for protein Puma of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3T2N1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Loxodonta africana GN=BBC3 (length=186 residues).
MARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGLCEPGLPRVAGPRLLPGPRTQLFPSPSPVWVSDLSGLQLERG
GAEWEDRAPRPLSGPQPSLSPAEQHLESPVPTQAAPGVRGEDEQWAREIGAQFRRKADDLYALYERSVRQEEQHRHRPSP
WRVLYNLIMGLLPLPRDHGAPEMEPN
© 1998-2018