Dataset for protein Bad of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3TP47_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Loxodonta africana GN=BAD (length=206 residues).
GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSSGGLQSMFQIPEFEQSDREDSTPADRGLGPSPEGYWPSGPSDRHRVA
PGFLRDSSHQQGQPTSSGHHGGAAAVETRSRHSSYPAGSDEAEGLEEDPSPFRGRSLSAPPNLWAAQRYGRELRRMSDEF
QGYFKGLPRPKSAGTATQMRQSPSWTRIIQAWWDRNLGRGSSAPSQ
© 1998-2018