Dataset for protein Bad of organism Lithobates catesbeiana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|C1C3S9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Lithobates catesbeiana GN=BAD (length=150 residues).
MGDSPHKSMFSIEEFPPTERGSAFSGTNPPGFGGDPGHKSSPNLRRIKGKETRQRTESASEASETDSVGELQHFRSRSRS
APSSLMVAARYGRELRRMSDEFDQIFTSIPRPKSASAATEMTVSKSFGETFFNFFRRKNKDRSQSENDKH
© 1998-2018