Dataset for protein classical BH3-containing proteins of organism Lepisosteus oculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5N4P7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Lepisosteus oculatus GN=BMF (length=153 residues).
MEEDEDDVFHPSHFSHCWGTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYGNAAFRLHFPAHFEQGGDEEE
ETGEAEEQPVRSAEVRIGQKLQRIGDQFHRDYLHMYRRNQRNHQPMWWRLALALFTFLFERQGNRNQLRGDQR
© 1998-2018