Dataset for protein classical BH3-containing proteins of organism Latimeria chalumnae

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|H3ANP3_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=170 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTVFWGFTDNMEILGRP
SSESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKG
RGQPRDPPGQ
>gnl|bcl2dbpro|H3ANP3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=173 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTDNMEILGRPSSESQI
SDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRD
PPGQQGVSIRGPD
>gnl|bcl2dbpro|H3ANP3_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=175 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTGVYGWVKLRKRNNME
ILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLI
RSLKGRGQPRDPPGQ
>gnl|bcl2dbpro|H3ANP3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=173 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTDNMEILGRPSSESQI
SDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRD
PPGQQGVSIRGPD
>gnl|bcl2dbpro|M3XHJ5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Latimeria chalumnae GN=BCL2L11 (length=158 residues).
MPTEESLQFDKDQGTSDVISECGHLHPTQRPDQPPFVKQEGCYCIISPLSKVIALVRWRDRSLLSTLMGGLLLPPSPCPF
VTRSPFFIFMRRSLVLSTSSSGYFTFDSDIVHSPAPVSVHKATQTPSPSSQLIVHVQHCLAQREQHPETHGKNPLNFT
© 1998-2018