Dataset for protein Bad of organism Latimeria chalumnae

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|H3ANP3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=173 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTDNMEILGRPSSESQI
SDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRD
PPGQQGVSIRGPD
>gnl|bcl2dbpro|H3ANP3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=173 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTDNMEILGRPSSESQI
SDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRD
PPGQQGVSIRGPD
>gnl|bcl2dbpro|H3ANP3_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=175 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTGVYGWVKLRKRNNME
ILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLI
RSLKGRGQPRDPPGQ
>gnl|bcl2dbpro|H3ANP3_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Latimeria chalumnae GN=BAD (length=170 residues).
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHTVFWGFTDNMEILGRP
SSESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKG
RGQPRDPPGQ
© 1998-2018