Dataset for protein classical BH3-containing proteins of organism Labrus bergylta

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q3ESW6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L11 (length=237 residues).
MHRPSRPPNRLDGSPTVTESHGTRGDPPQTSRSDNSGGRNFGRTDSTGGGEPDSPSRCRFKPVSPVDSLGVFQKRSIFHL
PRRASSGYFSYDGDSLPSSPLSPRPLTADKATQTPSPSGQVMQHALQRMTEAHGGGPGTQQQYGHSPSLTSRRQRTAAGD
MQAEAIGRDLQRIGDDYNRLLLWRMAGRHGRPEVHPNPQPHIQPEPTMLLCTGLMILLIGWIIYLRGNTNSHDHSQV
>gnl|bcl2dbpro|A0A3Q3GUU5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Labrus bergylta GN=BMF (length=157 residues).
MDDEEDDVFEPDPHSWRTYFQEIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRPLFYGNAGFRLHFPANFELVGDQEESG
QESELQQIGMEQQQPVAHSVEASIGLKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGAGRR
>gnl|bcl2dbpro|A0A3Q3MLA0_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Labrus bergylta GN=BAD (length=186 residues).
MAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELRLAGTGRIRLNSESHAYTVSRDEELQARGEEEAGT
PTEGAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQPKSQEFNTQLLQPH
VRCVLGSLNVYKWDYLILIITLHSSL
>gnl|bcl2dbpro|A0A3Q3MLA0_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Labrus bergylta GN=BAD (length=221 residues).
MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGVLDVTMAAKFTISDSESGSEEEVKEEENDQS
SAVEEPHVPQRHSLTLPELRLAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPPALWAAKKYGR
QLRRMSDEFDILLDKGEMKKVRSPGPAKQMHHSKSWWSYLFSHQETEGENNHHENHTHRNE
>gnl|bcl2dbpro|A0A3Q3MLA0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Labrus bergylta GN=BAD (length=195 residues).
MTLTASDVTMAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELRLAGTGRIRLNSESHAYTVSRDEELQ
ARGEEEAGTPTEGAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQPKSQE
FNTQLLQPHVRCVLGSLNVYKWDYLILIITLHSSL
© 1998-2019