Dataset for protein Bmf of organism Labrus bergylta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3GUU5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Labrus bergylta GN=BMF (length=157 residues).
MDDEEDDVFEPDPHSWRTYFQEIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRPLFYGNAGFRLHFPANFELVGDQEESG
QESELQQIGMEQQQPVAHSVEASIGLKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGAGRR
© 1998-2019